PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G327100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 457aa    MW: 51423.1 Da    PI: 6.9673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G327100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.47.5e-91214364374
                GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalkl.fsevsPilk 92 
                         +L++cA++v +g++e+++  L++++ l s ++ p+qRl   ++  La+rl+   ++ + al +ps+  e   ++ l+  ++ f ++sP++ 
  Sevir.7G327100.1.p  21 VLYACATHVIEGSFEKTDIDLSQIKRLTSIADGPLQRLSLIIADSLARRLLCPIQGFAGALiHPSDYFE---QSILQTARFnFTNLSPYIS 108
                         699*************************************************88888887745555553...3333333445********* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdi..sqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                          ++ t N aIlea+e e+ v iiD++   s++ QW+ Ll+ + +R++gpp++R+T+v++    +++ l +++  L+k Ae l++pf+fn  
  Sevir.7G327100.1.p 109 TGFATINWAILEAMEDEQVVRIIDLSCstSHPRQWLKLLRDFHERQGGPPEVRLTVVHD----DNDFLANMRALLSKEAEMLKIPFQFNS- 194
                         *************************86226899**************************....9**************************. PP

                GRAS 182 vakrledleleeL....rvkpgEalaVnlvlqlhrll..........................................desvsleserde 226
                         v  rle+l++++L    ++k gEa+a++++lq+hrll                                          + + ++++   +
  Sevir.7G327100.1.p 195 VIGRLETLDFSNLrntlDIKYGEAIAISCSLQMHRLLvvddvscsgigqlqkmaniaqlkqmsssvyspastlnypqtpSPQCQTPKLLVN 285
                         799999999988854447777*******************************************************998555556666778 PP

                GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl...preseerikvErellgreivnvvacegaerrerhetlek 314
                         +L++v  l+P+++ ++eq+a+hn+  F +rf+eal+yy+alfds++a +   pr s+er+ vEr++lg+ei+n++ ceg +r erhe+l++
  Sevir.7G327100.1.p 286 FLNAVCALKPNIMLMMEQDANHNALLFCDRFVEALNYYAALFDSFHAVIaanPRRSDERARVERMILGEEIKNILVCEGVHRYERHERLSQ 376
                         ********************************************977642227788*********************************** PP

                GRAS 315 WrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         W + ++++GF  vpls +a  + +  l  ++ +g + + es++l+l+W +  L+s+SaWr
  Sevir.7G327100.1.p 377 WAMHMNRSGFDHVPLSFRAIWEGNQKLMSFGLNGCQSKVESDCLLLCWGSTHLYSISAWR 436
                         ***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575125No hitNo description
PROSITE profilePS5098541.111416IPR005202Transcription factor GRAS
PfamPF035142.6E-8821436IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MYRPLLQDQG IADHLAQLGP VLYACATHVI EGSFEKTDID LSQIKRLTSI ADGPLQRLSL  60
IIADSLARRL LCPIQGFAGA LIHPSDYFEQ SILQTARFNF TNLSPYISTG FATINWAILE  120
AMEDEQVVRI IDLSCSTSHP RQWLKLLRDF HERQGGPPEV RLTVVHDDND FLANMRALLS  180
KEAEMLKIPF QFNSVIGRLE TLDFSNLRNT LDIKYGEAIA ISCSLQMHRL LVVDDVSCSG  240
IGQLQKMANI AQLKQMSSSV YSPASTLNYP QTPSPQCQTP KLLVNFLNAV CALKPNIMLM  300
MEQDANHNAL LFCDRFVEAL NYYAALFDSF HAVIAANPRR SDERARVERM ILGEEIKNIL  360
VCEGVHRYER HERLSQWAMH MNRSGFDHVP LSFRAIWEGN QKLMSFGLNG CQSKVESDCL  420
LLCWGSTHLY SISAWRPHKG STSGSREHML VSHSAK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-264043625375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616660.10.0PREDICTED: scarecrow-like protein 3 isoform X1
TrEMBLK3YDW30.0K3YDW3_SETIT; Uncharacterized protein
STRINGSi012421m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-86scarecrow-like 3